PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB07G21420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 149aa    MW: 15647.1 Da    PI: 10.7105
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB07G21420.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP119.12.2e-3737111175
                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                   +Cqve+C  dl+ea +y+rrhkvC++hsk pvvlv+gl+qrfCqqCsrfhel+ fD+ k+sCr+rL +h er  k
  OB07G21420.1  37 RCQVERCGIDLTEAGKYNRRHKVCQTHSKEPVVLVAGLRQRFCQQCSRFHELEAFDDMKKSCRNRLTGHKERGGK 111
                   6**********************************************************************9655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.0E-323299IPR004333Transcription factor, SBP-box
PROSITE profilePS5114127.70935112IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.08E-3336111IPR004333Transcription factor, SBP-box
PfamPF031101.3E-2938108IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
XGAGGASSSY SNSVAAASTR RGGGRAGGAA SGSVGPRCQV ERCGIDLTEA GKYNRRHKVC  60
QTHSKEPVVL VAGLRQRFCQ QCSRFHELEA FDDMKKSCRN RLTGHKERGG KGAGDRRAGR  120
GGENCRNGAD HDGRGHPGPG PGPGPFQIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2930111284squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT8995821e-74KT899582.1 Oryza sativa Japonica Group isolate GP7 GLW7 (GLW7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694645.11e-102PREDICTED: squamosa promoter-binding-like protein 13, partial
SwissprotQ6Z4619e-49SPL13_ORYSJ; Squamosa promoter-binding-like protein 13
TrEMBLJ3ML601e-102J3ML60_ORYBR; Uncharacterized protein
STRINGOB07G21420.11e-102(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP85243248
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.11e-28squamosa promoter binding protein-like 5